Searching alpha:[0* TO 9*] , total 396254 products,queries done in 47 ms
Orbital Hydraulic Motor Bmh-200/Bmh-250

Hydraulic Orbit Motor BMH *Advanced manufacturing devices for the Gerolor gear set, which use low pressure of start-up,provide smooth, reliable operation and high efficiency. *Shaft seal can bear high pressure of back and the motor can be used in parallel or series. *Special desi

Shijiazhuang Hanjiu Technology Co.,Ltd      [2017-10-16 17:09:20 ]

Orbital Hydraulic Motor Bms-80/Bms-100

Hydraulic orbit motor BMS BMS series motor adapt the advanced Gerotor gear set design with disc distribution flow and high pressure. The unit can be supplied the individual variant in operating multifunction in accordance with requirement of applications. Characteristic Features

Shijiazhuang Hanjiu Technology Co.,Ltd      [2017-10-16 17:05:59 ]

Orbital Hydraulic Motor Bmr-50 / OMR Series

Hydraulic Orbit Motor BMR BMR series motor adapt the advanced Gerolor gear set design with shaft distribution flow, which can automatically compensate in operating with high pressure , provide reliable and smooth operation, high efficiency and long life. Characteristic Features *

Shijiazhuang Hanjiu Technology Co.,Ltd      [2017-10-16 17:04:14 ]

Plastic Filter Fan Guard 60mm

Plastic Filter Fan Guard 60mm Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me .

Greatcooler Electronic Technology Co.,LTD      [2017-10-16 16:41:03 ]

120mm fan metal guard

120mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler MOQ 500PCS Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment . If you have any needs , pls feel free contact me .

Greatcooler Electronic Technology Co.,LTD      [2017-10-16 16:10:45 ]

Custom Ntag213 / 215 White Card, Game Card Design,14443A Agreement White Standard Original NTAG215 Chip NFC Electronic Label NFC Sticker Label Aikeyi Technology

Custom Ntag213 / 215 White Card, Game Card Design,14443A Agreement White Standard Original NTAG215 Chip NFC Electronic Label NFC Sticker Label Aikeyi Technology WeChat aky_01,Skype 13423626252,QQ 2880179620,WhatsApp 15011978320) Diameter 25mm,or customized Chip Model NTAG 215 Ope

Guangzhou AIKEYI Smart Card Technology Co.,Ltd.      [2017-10-16 15:42:14 ]

Buy amb-fubinaca,fub-amb,2-FMA,U-47700,nm-2201,MMBC,4F-PHP,ADBF,Hexen,5FADB,

Email ....... kathy@wh-wanli com Skype ........rcwanli@outlook com We provide and export high quality and purity research chemicals in large and small quantities ... our products is as below Our products are of high purity (above 99%).( Please email to kathy@wh-wanli com) 4MEC,BK

WUHAN Manley Biological Co.,ltd      [2017-10-16 14:54:13 ]

Aluminum alloy clasp hands 4 drawers steel office cabinet

Luoyang Iron King Trading Co., Ltd. Is a office furniture factory was established in 2 0 1 1. It is a professional metal furniture factory which is located in Luoyang, China. Iron King factory covers over 5, 3 0 0 square meters. Iron King group owns more than 6 0 skillful workers

LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD      [2017-10-16 14:42:58 ]

Sricam SP023 Night Vision with Full color H.264 HD720P Waterproof outdoor Bullet IP camera

Features 1 HD 960P(1280*960), 1.3 MP, H.264. 2 Night Vision Adopt new starlight level sensor, with shimmer night visioin is full color, IR distance 20M. 3 Lens 4mm, F16 Starlight level Lens with better ngith vision. 4 microSD Card Supports upto 64GB microSD card for recording and

Shenzhen Sricctv Technology Co.Ltd.      [2017-10-16 14:26:22 ]

H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled

Creative Peptides offers H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2db-human-gp100-tetramer-kvprnqdwl-apc-labeled-item-cpm-1-0034-33874.html for more infor

Creative Peptides      [2017-10-16 14:24:26 ]

HLA-E_01_03 HLA-A leader3-11 tetramer-VMAPRTLVL-PE labeled

Creative Peptides offers HLA-E_01_03 HLA-A leader3-11 tetramer-VMAPRTLVL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-e-hla-a-leader3-tetramer-vmaprtlvl-pe-labeled-item-cpm-1-0037-33877.html for

Creative Peptides      [2017-10-16 14:21:07 ]

HLA-A_11_01 EBV EBNA3B 416-424 tetramer-IVTDFSVIK-PE labeled

Creative Peptides offers HLA-A_11_01 EBV EBNA3B 416-424 tetramer-IVTDFSVIK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-ebv-ebna3b-tetramer-ivtdfsvik-pe-labeled-item-cpm-1-0038-33878.html for

Creative Peptides      [2017-10-16 14:20:40 ]

H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled

Creative Peptides offers H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2ld-hbsag-tetramer-ipqsldswwtsl-pe-labeled-item-cpm-1-0039-33879.html for more information.

Creative Peptides      [2017-10-16 14:18:15 ]

Phospho-Glycogen Synthase Peptide-2 (substrate)

We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications Ser-21 = OPO3H

Creative Peptides      [2017-10-16 14:13:43 ]

80mm fan metal guard

80mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any interest pls feel free contact me .

Greatcooler Electronic Technology Co.,LTD      [2017-10-16 14:12:47 ]

GLP-2 (rat)

CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on

Creative Peptides      [2017-10-16 14:12:09 ]

3 drawers Aluminum alloy clasp hands steel file cabinet

Product Name Filing cabinet Brand Feng Long Model FC-N3-3 Dimension H1031mm*W452mm*D620mm, per customer`s requirement Packing Volume 0.069CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furniture Port Qingdao,S

LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD      [2017-10-16 14:11:15 ]

4mm fan metal guard

4mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me .

Greatcooler Electronic Technology Co.,LTD      [2017-10-16 14:09:56 ]

LEP (116-130) (mouse)

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. More information please visit our website https://www creative-peptides com/product/lep-mouse-item-r0836-34638.html CAT#R0836 CAS No.258276-95-8 SequenceSCSLPQTSGLQKPES (Modif

Creative Peptides      [2017-10-16 14:09:27 ]

2 doors hang the garment bag integrated ark metal steel cabinet

Item Specifications Product Name Steel cabinet Brand Feng Long Model SC-L1 Dimension H900mm*W400mm*D900mm, per customer`s requirement Packing Volume 0.093CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furnitur

LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD      [2017-10-16 14:07:55 ]